General Information

  • ID:  hor006177
  • Uniprot ID:  P26742
  • Protein name:  Bombyxin B-8 B chain
  • Gene name:  BBXB8
  • Organism:  Bombyx mori (Silk moth)
  • Family:  Insulin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Bombyx (genus), Bombycinae (subfamily), Bombycidae (family), Bombycoidea (superfamily), Obtectomera , Ditrysia , Heteroneura (parvorder), Neolepidoptera (infraorder), Glossata (suborder), Lepidoptera (order), Amphiesmenoptera (superorder), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia , Insecta (class), Hexapoda (subphylum), Pancrustacea , Mandibulata , Arthropoda (phylum), Panarthropoda , Ecdysozoa , Protostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0008083 growth factor activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  EAQEVARTYCGSHLADTLADLCFGVV
  • Length:  26
  • Propeptide:  MKTSVIFVLIVLNLMWSGEAQEVARTYCGSHLADTLADLCFGVVKRGGAQYAPYFWQKAYLGSRGKRGVVDECCFRPCTLDVLASYCG
  • Signal peptide:  MKTSVIFVLIVLNLMWSG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Brain peptide responsible for activation of prothoracic glands to produce ecdysone in insects.
  • Mechanism:  Silk worm has two kinds of PTTH: 4K-PTTH and 22K-PTTH; there are many forms of 4K-PTTH.
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P26742-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006177_AF2.pdbhor006177_ESM.pdb

Physical Information

Mass: 321523 Formula: C119H186N32O40S2
Absent amino acids: IKMNPW Common amino acids: A
pI: 4.1 Basic residues: 2
Polar residues: 8 Hydrophobic residues: 11
Hydrophobicity: 36.54 Boman Index: -2332
Half-Life: 1 hour Half-Life Yeast: 30 min
Half-Life E.Coli: >10 hour Aliphatic Index 93.85
Instability Index: 471.15 Extinction Coefficient cystines: 1615
Absorbance 280nm: 64.6

Literature

  • PubMed ID:  8683595
  • Title:  Multiple gene copies for bombyxin, an insulin-related peptide of the silkmoth Bombyx mori: structural signs for gene rearrangement and duplication responsible for generation of multiple molecular forms of bombyxin.